I'm new in StackOverflow and JavaScript, I'm trying to get the first letter that repeats from a string considering both uppercase and lowercase letters and counting and obtaining results using the for statement. The problem is that the form I used is too long Analyzing the situation reaches such a point that maybe you can only use a "For" statement for this exercise, which I get to iterate, but not with a cleaner and reduced code has me completely blocked, this is the reason why I request help to understand and continue with the understanding and use of this sentence. In this case, the result was tested in a JavaScript script inside a function and 3 "For" sentences obtaining quite positive results, but I can not create it in 1 only For (Sorry for my bad english google translate)
I making in HTML with JavasScript
var letter = "SYAHSVCXCyXSssssssyBxAVMZsXhZV";
var contendor = [];
var calc = [];
var mycalc = 0;
letter = letter.toUpperCase()
console.log(letter)
function repeats(){
for (var i = 0; i < letter.length; i++) {
if (contendor.includes(letter[i])) {
}else{
contendor.push(letter[i])
calc.push(0)
}
}
for (var p = 0; p < letter.length; p++) {
for (var l = 0; l < contendor.length; l++) {
if (letter[p] == contendor[l]) {
calc [l]= calc [l]+1
}
}
}
for (var f = 0; f < calc.length; f++) {
if ( calc[f] > calc[mycalc]) {
mycalc = f
}
}
}
repeats()
console.log("The most repeated letter its: " + contendor[mycalc]);
I Expected: A result with concise code
It would probably be a lot more concise to use a regular expression: match a character, then lookahead for more characters until you can match that first character again:
var letter = "SYAHSVCXCyXSssssssyBxAVMZsXhZV";
const firstRepeatedRegex = /(.)(?=.*\1)/;
console.log(letter.match(firstRepeatedRegex)[1]);
Of course, if you aren't sure whether a given string contains a repeated character, check that the match isn't null before trying to extract the character:
const input = 'abcde';
const firstRepeatedRegex = /(.)(?=.*\1)/;
const match = input.match(firstRepeatedRegex);
if (match) {
console.log(match[0]);
} else {
console.log('No repeated characters');
}
You could also turn the input into an array and use .find to find the first character whose lastIndexOf is not the same as the index of the character being iterated over:
const getFirstRepeatedCharacter = (str) => {
const chars = [...str];
const char = chars.find((char, i) => chars.lastIndexOf(char) !== i);
return char || 'No repeated characters';
};
console.log(getFirstRepeatedCharacter('abcde'));
console.log(getFirstRepeatedCharacter('SYAHSVCXCyXSssssssyBxAVMZsXhZV'));
If what you're actually looking for is the character that occurs most often, case-insensitive, use reduce to transform the string into an object indexed by character, whose values are the number of occurrences of that character, then identify the largest value:
const getMostRepeatedCharacter = (str) => {
const charsByCount = [...str.toUpperCase()].reduce((a, char) => {
a[char] = (a[char] || 0) + 1;
return a;
}, {});
const mostRepeatedEntry = Object.entries(charsByCount).reduce((a, b) => a[1] >= b[1] ? a : b);
return mostRepeatedEntry[0];
};
console.log(getMostRepeatedCharacter('abcde'));
console.log(getMostRepeatedCharacter('SYAHSVCXCyXSssssssyBxAVMZsXhZV'));
If the first repeated character is what you want, you can push it into an array and check if the character already exists
function getFirstRepeating( str ){
chars = []
for ( var i = 0; i < str.length; i++){
var char = str.charAt(i);
if ( chars.includes( char ) ){
return char;
} else {
chars.push( char );
}
}
return -1;
}
This will return the first repeating character if it exists, or will return -1.
Working
function getFirstRepeating( str ){
chars = []
for ( var i = 0; i < str.length; i++){
var char = str.charAt(i);
if ( chars.includes( char ) ){
return char;
} else {
chars.push( char );
}
}
return -1;
}
console.log(getFirstRepeating("SYAHSVCXCyXSssssssyBxAVMZsXhZV"))
Have you worked with JavaScript objects yet?
You should look into it.
When you loop through your string
let characters = "hemdhdksksbbd";
let charCount = {};
let max = { count: 0, ch: ""}; // will contain max
// rep letter
//Turn string into an array of letters and for
// each letter create a key in the charcount
// object , set it to 1 (meaning that's the first of
// that letter you've found) and any other time
// you see the letter, increment by 1.
characters.split("").forEach(function(character)
{
if(!charCount[character])
charCount[character] = 1;
else
charCount[character]++;
}
//charCount should now contain letters and
// their counts.
//Get the letters from charCount and find the
// max count
Object.keys(charCount). forEach (function(ch){
if(max.count < charCount[ch])
max = { count: charCount[ch], ch: ch};
}
console.log("most reps is: " , max.ch);
This is a pretty terrible solution. It takes 2 loops (reduce) and doesn't handle ties, but it's short and complicated.
Basically keep turning the results into arrays and use array methods split and reduce to find the answer. The first reduce is wrapped in Object.entries() to turn the object back into an array.
let letter = Object.entries(
"SYAHSVCXCyXSssssssyBxAVMZsXhZV".
toUpperCase().
split('').
reduce((p, c) => {
p[c] = isNaN(++p[c]) ? 1 : p[c];
return p;
}, {})
).
reduce((p, c) => p = c[1] > p[1] ? c : p);
console.log(`The most repeated letter is ${letter[0]}, ${letter[1]} times.`);
I have a page with a grid where user's numbers get saved. It has a following pattern - every number ends with 3 digits after comma. It doesn't look nice, when for example user's input is
123,450
123,670
123,890
It's much better to have just 2 numbers after comma, because last 0 is absolutely meaningless and redundant.
The way it still should have 3 digits is only if at least one element in an array doesn't end up with 0
For example:
123,455
123,450
123,560
In this case 1st element of the array has the last digit not equal to 0 and hence all the elements should have 3 digits. The same story with 2 or 1 zeros
Zeros are redundant:
123,30
123,40
123,50
Zeros are necessary:
123,35
123,40
123,50
The question is how can I implement it programatically? I've started like this:
var zeros2Remove = 0;
numInArray.forEach(function(item, index, numInArray)
{
var threeDigitsAfterComma = item.substring(item.indexOf(',') + 1);
for(var j = 2; j <= 0; j--)
{
if(threeDigitsAfterComma[j] == 0)
{
zeros2Remove =+ 1;
}
else //have no idea what to do..
}
})
Well in my implementation I don't know how to do it since I have to iterate through every element but break it if at least 1 number has a last digit equal to zero.. In order to do that I have to break outer loop, but don't know how and I'm absolutely sure that I don't have to...
I think the following code what you are looking for exactly , please manipulate numbers and see the changes :
var arr = ["111.3030", "2232.0022", "3.001000", "4","558.0200","55.00003000000"];
var map = arr.map(function(a) {
if (a % 1 === 0) {
var res = "1";
} else {
var lastNumman = a.toString().split('').pop();
if (lastNumman == 0) {
var m = parseFloat(a);
var res = (m + "").split(".")[1].length;
} else {
var m = a.split(".")[1].length;
var res = m;
}
}
return res;
})
var maxNum = map.reduce(function(a, b) {
return Math.max(a, b);
});
arr.forEach(function(el) {
console.log(Number.parseFloat(el).toFixed(maxNum));
});
According to MDN,
There is no way to stop or break a forEach() loop other than by throwing an exception. If you need such behavior, the forEach() method is the wrong tool. Use a plain loop or for...of instead.
If you convert your forEach loop to a for loop, you can break out of it with a label and break statement:
// unrelated example
let i;
let j;
outerLoop:
for (i = 2; i < 100; ++i) {
innerLoop:
for (j = 2; j < 100; ++j) {
// brute-force prime factorization
if (i * j === 2183) { break outerLoop; }
}
}
console.log(i, j);
I gave you an unrelated example because your problem doesn't need nested loops at all. You can find the number of trailing zeroes in a string with a regular expression:
function getTrailingZeroes (str) {
return str.match(/0{0,2}$/)[0].length;
}
str.match(/0{0,2}$/) finds between 0 and 2 zeroes at the end of str and returns them as a string in a one-element array. The length of that string is the number of characters you can remove from str. You can make one pass over your array of number-strings, breaking out when necessary, and use Array.map as a separate truncation loop:
function getShortenedNumbers (numInArray) {
let zeroesToRemove = Infinity;
for (const str of numInArray) {
let candidate = getTrailingZeroes(str);
zeroesToRemove = Math.min(zeroesToRemove, candidate);
if (zeroesToRemove === 0) break;
}
return numInArray.map(str => str.substring(0, str.length - zeroesToRemove);
}
All together:
function getTrailingZeroes (str) {
return str.match(/0{0,2}$/)[0].length;
}
function getShortenedNumbers (numInArray) {
let zeroesToRemove = Infinity;
for (const str of numInArray) {
let candidate = getTrailingZeroes(str);
zeroesToRemove = Math.min(zeroesToRemove, candidate);
if (zeroesToRemove === 0) break;
}
return numInArray.map(str => str.substring(0, str.length - zeroesToRemove));
}
console.log(getShortenedNumbers(['123,450', '123,670', '123,890']));
console.log(getShortenedNumbers(['123,455', '123,450', '123,560']));
This solution might seem a little cumbersome but it should work for all possible scenarios. It should be easy enough to make always return a minimal number of decimals places/leading zeros.
I hope it helps.
// Define any array
const firstArray = [
'123,4350',
'123,64470',
'123,8112390',
]
const oneOfOfYourArrays = [
'123,30',
'123,40',
'123,50',
]
// Converts 123,45 to 123.45
function stringNumberToFloat(stringNumber) {
return parseFloat(stringNumber.replace(',', '.'))
}
// For 123.45 you get 2
function getNumberOfDecimals(number) {
return number.split('.')[1].length;
}
// This is a hacky way how to remove traling zeros
function removeTralingZeros(stringNumber) {
return stringNumberToFloat(stringNumber).toString()
}
// Sorts numbers in array by number of their decimals
function byNumberOfValidDecimals(a, b) {
const decimalsA = getNumberOfDecimals(a)
const decimalsB = getNumberOfDecimals(b)
return decimalsB - decimalsA
}
// THIS IS THE FINAL SOLUTION
function normalizeDecimalPlaces(targetArray) {
const processedArray = targetArray
.map(removeTralingZeros) // We want to remove trailing zeros
.sort(byNumberOfValidDecimals) // Sort from highest to lowest by number of valid decimals
const maxNumberOfDecimals = processedArray[0].split('.')[1].length
return targetArray.map((stringNumber) => stringNumberToFloat(stringNumber).toFixed(maxNumberOfDecimals))
}
console.log('normalizedFirstArray', normalizeDecimalPlaces(firstArray))
console.log('normalizedOneOfOfYourArrays', normalizeDecimalPlaces(oneOfOfYourArrays))
Try this
function removeZeros(group) {
var maxLength = 0;
var newGroup = [];
for(var x in group) {
var str = group[x].toString().split('.')[1];
if(str.length > maxLength) maxLength = str.length;
}
for(var y in group) {
var str = group[y].toString();
var substr = str.split('.')[1];
if(substr.length < maxLength) {
for(var i = 0; i < (maxLength - substr.length); i++)
str += '0';
}
newGroup.push(str);
}
return newGroup;
}
Try it on jsfiddle: https://jsfiddle.net/32sdvzn1/1/
My script checks the length of every number decimal part, remember that JavaScript removes the last zeros in a decimal number, so 3.10 would be 3.1, so the length is less when there is a number with zeros in the end, in this case we just add a zero to the number.
Update
I've updated the script, the new version adds as much zeros as the different between the max decimal length and the decimal length of the analyzed number.
Example
We have: 3.11, 3.1423, 3.1
The max length would be: 4 (1423)
maxLenght (4) - length of .11 (2) = 2
We add 2 zeros to 3.11, that will become 3.1100
I think you can start out assuming you will remove two extra zeros, and loop through your array looking for digits in the last two places. With the commas, I'm assuming your numArray elements are strings, all starting with the same length.
var numArray = ['123,000', '456,100', '789,110'];
var removeTwo = true, removeOne = true;
for (var i = 0; i < numArray.length; i++) {
if (numArray[i][6] !== '0') { removeTwo = false; removeOne = false; }
if (numArray[i][5] !== '0') { removeTwo = false; }
}
// now loop to do the actual removal
for (var i = 0; i < numArray.length; i++) {
if (removeTwo) {
numArray[i] = numArray[i].substr(0, 5);
} else if (removeOne) {
numArray[i] = numArray[i].substr(0, 6);
}
}
Say you have the following string:
FJKAUNOJDCUTCRHBYDLXKEODVBWTYPTSHASQQFCPRMLDXIJMYPVOHBDUGSMBLMVUMMZYHULSUIZIMZTICQORLNTOVKVAMQTKHVRIFMNTSLYGHEHFAHWWATLYAPEXTHEPKJUGDVWUDDPRQLUZMSZOJPSIKAIHLTONYXAULECXXKWFQOIKELWOHRVRUCXIAASKHMWTMAJEWGEESLWRTQKVHRRCDYXNT
LDSUPXMQTQDFAQAPYBGXPOLOCLFQNGNKPKOBHZWHRXAWAWJKMTJSLDLNHMUGVVOPSAMRUJEYUOBPFNEHPZZCLPNZKWMTCXERPZRFKSXVEZTYCXFRHRGEITWHRRYPWSVAYBUHCERJXDCYAVICPTNBGIODLYLMEYLISEYNXNMCDPJJRCTLYNFMJZQNCLAGHUDVLYIGASGXSZYPZKLAWQUDVNTWGFFY
FFSMQWUNUPZRJMTHACFELGHDZEJWFDWVPYOZEVEJKQWHQAHOCIYWGVLPSHFESCGEUCJGYLGDWPIWIDWZZXRUFXERABQJOXZALQOCSAYBRHXQQGUDADYSORTYZQPWGMBLNAQOFODSNXSZFURUNPMZGHTAJUJROIGMRKIZHSFUSKIZJJTLGOEEPBMIXISDHOAIFNFEKKSLEXSJLSGLCYYFEQBKIZZTQQ
XBQZAPXAAIFQEIXELQEZGFEPCKFPGXULLAHXTSRXDEMKFKABUTAABSLNQBNMXNEPODPGAORYJXCHCGKECLJVRBPRLHORREEIZOBSHDSCETTTNFTSMQPQIJBLKNZDMXOTRBNMTKHHCZQQMSLOAXJQKRHDGZVGITHYGVDXRTVBJEAHYBYRYKJAVXPOKHFFMEPHAGFOOPFNKQAUGYLVPWUJUPCUGGIXGR
AMELUTEPYILBIUOCKKUUBJROQFTXMZRLXBAMHSDTEKRRIKZUFNLGTQAEUINMBPYTWXULQNIIRXHHGQDPENXAJNWXULFBNKBRINUMTRBFWBYVNKNKDFR
I'm trying to find the smallest substring containing the letters ABCDA.
I tried a regex approach.
console.log(str.match(/[A].*?[B].*?[C].*?[D].*?[A]/gm).sort((a, b) => a.length - b.length)[0]);
This works, but it only find strings where ABCDA appear (in that order). Meaning it won't find substring where the letters appear in a order like this: BCDAA
I'm trying to change my regex to account for this. How would I do that without using | and type out all the different cases?
You can't.
Let's consider a special case: Assume the letters you are looking for are A, A, and B. At some point in your regexp there will certainly be a B. However, the parts to the left and to the right of the B are independent of each other, so you cannot refer from one to the other. How many As are matched in the subexpression to the right of the B depends on the number of As being already matched in the left part. This is not possible with regular expressions, so you will have to unfold all the different orders, which can be many!
Another popular example that illustrates the problem is to match opening brackets with closing brackets. It's not possible to write a regular expression asserting that in a given string a sequence of opening brackets is followed by a sequence of closing brackets of the same length. The reason for this is that to count the brackets you would need a stack machine in contrast to a finite state machine but regular expressions are limited to patterns that can be matched using FSMs.
This algorithm doesn't use a regex, but found both solutions as well.
var haystack = 'FJKAUNOJDCUTCRHBYDLXKEODVBWTYPTSHASQQFCPRMLDXIJMYPVOHBDUGSMBLMVUMMZYHULSUIZIMZTICQORLNTOVKVAMQTKHVRIFMNTSLYGHEHFAHWWATLYAPEXTHEPKJUGDVWUDDPRQLUZMSZOJPSIKAIHLTONYXAULECXXKWFQOIKELWOHRVRUCXIAASKHMWTMAJEWGEESLWRTQKVHRRCDYXNTLDSUPXMQTQDFAQAPYBGXPOLOCLFQNGNKPKOBHZWHRXAWAWJKMTJSLDLNHMUGVVOPSAMRUJEYUOBPFNEHPZZCLPNZKWMTCXERPZRFKSXVEZTYCXFRHRGEITWHRRYPWSVAYBUHCERJXDCYAVICPTNBGIODLYLMEYLISEYNXNMCDPJJRCTLYNFMJZQNCLAGHUDVLYIGASGXSZYPZKLAWQUDVNTWGFFYFFSMQWUNUPZRJMTHACFELGHDZEJWFDWVPYOZEVEJKQWHQAHOCIYWGVLPSHFESCGEUCJGYLGDWPIWIDWZZXRUFXERABQJOXZALQOCSAYBRHXQQGUDADYSORTYZQPWGMBLNAQOFODSNXSZFURUNPMZGHTAJUJROIGMRKIZHSFUSKIZJJTLGOEEPBMIXISDHOAIFNFEKKSLEXSJLSGLCYYFEQBKIZZTQQXBQZAPXAAIFQEIXELQEZGFEPCKFPGXULLAHXTSRXDEMKFKABUTAABSLNQBNMXNEPODPGAORYJXCHCGKECLJVRBPRLHORREEIZOBSHDSCETTTNFTSMQPQIJBLKNZDMXOTRBNMTKHHCZQQMSLOAXJQKRHDGZVGITHYGVDXRTVBJEAHYBYRYKJAVXPOKHFFMEPHAGFOOPFNKQAUGYLVPWUJUPCUGGIXGRAMELUTEPYILBIUOCKKUUBJROQFTXMZRLXBAMHSDTEKRRIKZUFNLGTQAEUINMBPYTWXULQNIIRXHHGQDPENXAJNWXULFBNKBRINUMTRBFWBYVNKNKDFR';
var needle = 'ABCDA'; // the order of letters doesn't matter
var letters = {};
needle.split('').forEach(function(ch) {
letters[ch] = letters[ch] || 0;
letters[ch]++;
});
var shortestSubstringLength = haystack.length;
var shortestSubstrings = []; // storage for found substrings
var startingPos = 0;
var length;
var currentPos;
var notFound;
var letterKeys = Object.keys(letters); // unique leters
do {
lettersLeft = JSON.parse(JSON.stringify(letters)); // copy letters count object
notFound = false;
posStart = haystack.length;
posEnd = 0;
letterKeys.forEach(function(ch) {
currentPos = startingPos;
while (!notFound && lettersLeft[ch] > 0) {
currentPos = haystack.indexOf(ch, currentPos);
if (currentPos >= 0) {
lettersLeft[ch]--;
posStart = Math.min(currentPos, posStart);
posEnd = Math.max(currentPos, posEnd);
currentPos++;
} else {
notFound = true;
}
}
});
if (!notFound) {
length = posEnd - posStart + 1;
startingPos = posStart + 1; // starting position for next iteration
}
if (!notFound && length === shortestSubstringLength) {
shortestSubstrings.push(haystack.substr(posStart, length));
}
if (!notFound && length < shortestSubstringLength) {
shortestSubstrings = [haystack.substr(posStart, length)];
shortestSubstringLength = length;
}
} while (!notFound);
console.log(shortestSubstrings);
Maybe not as clear as using regex could be (well, for me regex are never really clear :D ) you can use brute force (not so brute)
Create an index of "valid" points of your string (those with the letters you want) and iterate with a double loop over it getting substrings containing at least 5 of those points, checking that they are valid solutions. Maybe not the most efficient way, but easy to implement, to understand, and probably to optimize.
var haystack="UGDVWUDDPRQLUZMSZOJPSIKAIHLTONYXAULECXXKWFQOIKELWOHRVRUCXIAASKHMWTMAJEWGEESLWRTQKVHRRCDYXNTLDSUPXMQTQDFAQAPYBGXPOLOCLFQNGNKPKOBHZWHRXAWAWJKMTJSLDLNHMUGVVOPSAMRUJEYUOBPFNEHPZZCLPNZKWMTCXERPZRFKSXVEZTYCXFRHRGEITWHRRYPWSVAYBUHCERJXDCYAVICPTNBGIODLYLMEYLISEYNXNMCDPJJRCTLYNFMJZQNCLAGHUDVLYIGASGXSZYPZKLAWQUDVNTWGFFYFFSMQWUNUPZRJMTHACFELGHDZEJWFDWVPYOZEVEJKQWHQAHOCIYWGVLPSHFESCGEUCJGYLGDWPIWIDWZZXRUFXERABQJOXZALQOCSAYBRHXQQGUDADYSORTYZQPWGMBLNAQOFODSNXSZFURUNPMZGHTAJUJROIGMRKIZHSFUSKIZJJTLGOEEPBMIXISDHOAIFNFEKKSLEXSJLSGLCYYFEQBKIZZTQQXBQZAPXAAIFQEIXELQEZGFEPCKFPGXULLAHXTSRXDEMKFKABUTAABSLNQBNMXNEPODPGAORYJXCHCGKECLJVRBPRLHORREEIZOBSHDSCETTTNFTSMQPQIJBLKNZDMXOTRBNMTKHHCZQQMSLOAXJQKRHDGZVGITHYGVDXRTVBJEAHYBYRYKJAVXPOKHFFMEPHAGFOOPFNKQAUGYLVPWUJUPCUGGIXGR";
var needle="ABCD";
var size=haystack.length;
var candidate_substring="";
var minimal_length=size;
var solutions=new Array();
var points=Array();
for(var i=0;i<size;i++){
if(needle.indexOf(haystack[i])>-1) points.push(i);
}
var limit_i= points.length-4;
var limit_k= points.length;
for (var i=0;i<limit_i;i++){
for(var k=i;k<limit_k;k++){
if(points[k]-points[i]+1<=minimal_length){
candidate_substring=haystack.substr(points[i],points[k]-points[i]+1);
if(is_valid(candidate_substring)){
solutions.push(candidate_substring);
if(candidate_substring.length < minimal_length) minimal_length=candidate_substring.length;
}
}
}
}
document.write('<p>Solution length:'+minimal_length+'<p>');
for(var i=0;i<solutions.length;i++){
if(solutions[i].length<=minimal_length) document.write('<p>Solution:'+solutions[i]+'<p>');
}
function is_valid(candidate_substring){
//verify we've got all characters
for(var j=0;j<candidate_substring.length;j++){
if(candidate_substring.indexOf(needle.charAt(j))<0) return false;
}
//...and verify we have two "A"
if(candidate_substring.indexOf("A")==candidate_substring.lastIndexOf("A")) return false;
return true;
}
Just had this problem in an interview as a coding assignment and came up with another solution, (it's not as optimal as the one above but maybe it's easier to understand).
function MinWindowSubstring(strArr) {
const N = strArr[0];
const K = strArr[1];
const letters = {};
K.split('').forEach( (character) => {
letters[character] = letters[character] ? letters[character] + 1 : 1;
});
let possibleSequencesList = [];
const letterKeys = Object.keys(letters);
for(let i=0; i< N.length; i++) {
const char = N[i];
if (new String(letterKeys).indexOf(char) !== -1) {
// found a character in the string
// update all previus sequences
possibleSequencesList.forEach((seq) => {
if(!seq.sequenceComplete) {
seq[char] = seq[char]-1;
seq.lastIndex = i;
// check if sequence is complete
var sequenceComplete = true;
letterKeys.forEach( (letter) => {
if(seq[letter] > 0) {
sequenceComplete = false;
}
});
seq.sequenceComplete = sequenceComplete
}
})
// create a new sequence starting from it
const newSeq = {
startPoint: i,
lastIndex: i,
sequenceComplete: false,
...letters
}
newSeq[char] = newSeq[char]-1;
possibleSequencesList.push(newSeq);
}
}
// cleanup sequences
let sequencesList = possibleSequencesList.filter(sequence => sequence.sequenceComplete);
let output = [];
let minLength = N.length;
// find the smalles one
sequencesList.forEach( seq => {
if( (seq.lastIndex - seq.startPoint) < minLength) {
minLength = seq.lastIndex - seq.startPoint;
output = N.substring(seq.startPoint, seq.lastIndex + 1);
}
})
return output;
}
I need to count the number of occurrences of a character in a string.
For example, suppose my string contains:
var mainStr = "str1,str2,str3,str4";
I want to find the count of comma , character, which is 3. And the count of individual strings after the split along comma, which is 4.
I also need to validate that each of the strings i.e str1 or str2 or str3 or str4 should not exceed, say, 15 characters.
I have updated this answer. I like the idea of using a match better, but it is slower:
console.log(("str1,str2,str3,str4".match(/,/g) || []).length); //logs 3
console.log(("str1,str2,str3,str4".match(new RegExp("str", "g")) || []).length); //logs 4
Use a regular expression literal if you know what you are searching for beforehand, if not you can use the RegExp constructor, and pass in the g flag as an argument.
match returns null with no results thus the || []
The original answer I made in 2009 is below. It creates an array unnecessarily, but using a split is faster (as of September 2014). I'm ambivalent, if I really needed the speed there would be no question that I would use a split, but I would prefer to use match.
Old answer (from 2009):
If you're looking for the commas:
(mainStr.split(",").length - 1) //3
If you're looking for the str
(mainStr.split("str").length - 1) //4
Both in #Lo's answer and in my own silly performance test split comes ahead in speed, at least in Chrome, but again creating the extra array just doesn't seem sane.
There are at least five ways. The best option, which should also be the fastest (owing to the native RegEx engine) is placed at the top.
Method 1
("this is foo bar".match(/o/g)||[]).length;
// returns 2
Method 2
"this is foo bar".split("o").length - 1;
// returns 2
Split not recommended as it is resource hungry. It allocates new instances of 'Array' for each match. Don't try it for a >100MB file via FileReader. You can observe the exact resource usage using Chrome's profiler option.
Method 3
var stringsearch = "o"
,str = "this is foo bar";
for(var count=-1,index=-2; index != -1; count++,index=str.indexOf(stringsearch,index+1) );
// returns 2
Method 4
Searching for a single character
var stringsearch = "o"
,str = "this is foo bar";
for(var i=count=0; i<str.length; count+=+(stringsearch===str[i++]));
// returns 2
Method 5
Element mapping and filtering. This is not recommended due to its overall resource preallocation rather than using Pythonian 'generators':
var str = "this is foo bar"
str.split('').map( function(e,i){ if(e === 'o') return i;} )
.filter(Boolean)
//>[9, 10]
[9, 10].length
// returns 2
Share:
I made this gist, with currently 8 methods of character-counting, so we can directly pool and share our ideas - just for fun, and perhaps some interesting benchmarks :)
Add this function to sting prototype :
String.prototype.count=function(c) {
var result = 0, i = 0;
for(i;i<this.length;i++)if(this[i]==c)result++;
return result;
};
usage:
console.log("strings".count("s")); //2
Simply, use the split to find out the number of occurrences of a character in a string.
mainStr.split(',').length // gives 4 which is the number of strings after splitting using delimiter comma
mainStr.split(',').length - 1 // gives 3 which is the count of comma
A quick Google search got this (from http://www.codecodex.com/wiki/index.php?title=Count_the_number_of_occurrences_of_a_specific_character_in_a_string#JavaScript)
String.prototype.count=function(s1) {
return (this.length - this.replace(new RegExp(s1,"g"), '').length) / s1.length;
}
Use it like this:
test = 'one,two,three,four'
commas = test.count(',') // returns 3
You can also rest your string and work with it like an array of elements using
Array.prototype.filter()
const mainStr = 'str1,str2,str3,str4';
const commas = [...mainStr].filter(l => l === ',').length;
console.log(commas);
Or
Array.prototype.reduce()
const mainStr = 'str1,str2,str3,str4';
const commas = [...mainStr].reduce((a, c) => c === ',' ? ++a : a, 0);
console.log(commas);
UPDATE: This might be simple, but it is not the fastest. See benchmarks below.
It's amazing that in 13 years, this answer hasn't shown up. Intuitively, it seems like it should be fastest:
const s = "The quick brown fox jumps over the lazy dog.";
const oCount = s.length - s.replaceAll('o', '').length;
If there are only two kinds of character in the string, then this is faster still:
const s = "001101001";
const oneCount = s.replaceAll('0', '').length;
BENCHMARKS
const { performance } = require('node:perf_hooks');
const ITERATIONS = 10000000;
const TEST_STRING = "The quick brown fox jumps over the lazy dog.";
console.log(ITERATIONS, "iterations");
let sum = 0; // make sure compiler doesn't optimize code out
let start = performance.now();
for (let i = 0; i < ITERATIONS; ++i) {
sum += TEST_STRING.length - TEST_STRING.replaceAll('o', '').length;
}
let end = performance.now();
console.log(" replaceAll duration", end - start, `(sum ${sum})`);
sum = 0;
start = performance.now();
for (let i = 0; i < ITERATIONS; ++i) {
sum += TEST_STRING.split('o').length - 1
}
end = performance.now();
console.log(" split duration", end - start, `(sum ${sum})`);
10000 iterations
replaceAll duration 2.6167500019073486 (sum 40000)
split duration 2.0777920186519623 (sum 40000)
100000 iterations
replaceAll duration 17.563208997249603 (sum 400000)
split duration 8.087624996900558 (sum 400000)
1000000 iterations
replaceAll duration 128.71587499976158 (sum 4000000)
split duration 64.15841698646545 (sum 4000000)
10000000 iterations
replaceAll duration 1223.3415840268135 (sum 40000000)
split duration 629.1629169881344 (sum 40000000)
Here is a similar solution, but it uses Array.prototype.reduce
function countCharacters(char, string) {
return string.split('').reduce((acc, ch) => ch === char ? acc + 1: acc, 0)
}
As was mentioned, String.prototype.split works much faster than String.prototype.replace.
If you are using lodash, the _.countBy method will do this:
_.countBy("abcda")['a'] //2
This method also work with array:
_.countBy(['ab', 'cd', 'ab'])['ab'] //2
ok, an other one with regexp - probably not fast, but short and better readable then others, in my case just '_' to count
key.replace(/[^_]/g,'').length
just remove everything that does not look like your char
but it does not look nice with a string as input
I have found that the best approach to search for a character in a very large string (that is 1 000 000 characters long, for example) is to use the replace() method.
window.count_replace = function (str, schar) {
return str.length - str.replace(RegExp(schar), '').length;
};
You can see yet another JSPerf suite to test this method along with other methods of finding a character in a string.
Performance of Split vs RegExp
var i = 0;
var split_start = new Date().getTime();
while (i < 30000) {
"1234,453,123,324".split(",").length -1;
i++;
}
var split_end = new Date().getTime();
var split_time = split_end - split_start;
i= 0;
var reg_start = new Date().getTime();
while (i < 30000) {
("1234,453,123,324".match(/,/g) || []).length;
i++;
}
var reg_end = new Date().getTime();
var reg_time = reg_end - reg_start;
alert ('Split Execution time: ' + split_time + "\n" + 'RegExp Execution time: ' + reg_time + "\n");
I made a slight improvement on the accepted answer, it allows to check with case-sensitive/case-insensitive matching, and is a method attached to the string object:
String.prototype.count = function(lit, cis) {
var m = this.toString().match(new RegExp(lit, ((cis) ? "gi" : "g")));
return (m != null) ? m.length : 0;
}
lit is the string to search for ( such as 'ex' ), and cis is case-insensitivity, defaulted to false, it will allow for choice of case insensitive matches.
To search the string 'I love StackOverflow.com' for the lower-case letter 'o', you would use:
var amount_of_os = 'I love StackOverflow.com'.count('o');
amount_of_os would be equal to 2.
If we were to search the same string again using case-insensitive matching, you would use:
var amount_of_os = 'I love StackOverflow.com'.count('o', true);
This time, amount_of_os would be equal to 3, since the capital O from the string gets included in the search.
Easiest way i found out...
Example-
str = 'mississippi';
function find_occurences(str, char_to_count){
return str.split(char_to_count).length - 1;
}
find_occurences(str, 'i') //outputs 4
Here is my solution. Lots of solution already posted before me. But I love to share my view here.
const mainStr = 'str1,str2,str3,str4';
const commaAndStringCounter = (str) => {
const commas = [...str].filter(letter => letter === ',').length;
const numOfStr = str.split(',').length;
return `Commas: ${commas}, String: ${numOfStr}`;
}
// Run the code
console.log(commaAndStringCounter(mainStr)); // Output: Commas: 3, String: 4
Here you find my REPL
I just did a very quick and dirty test on repl.it using Node v7.4. For a single character, the standard for loop is quickest:
Some code:
// winner!
function charCount1(s, c) {
let count = 0;
c = c.charAt(0); // we save some time here
for(let i = 0; i < s.length; ++i) {
if(c === s.charAt(i)) {
++count;
}
}
return count;
}
function charCount2(s, c) {
return (s.match(new RegExp(c[0], 'g')) || []).length;
}
function charCount3(s, c) {
let count = 0;
for(ch of s) {
if(c === ch) {
++count;
}
}
return count;
}
function perfIt() {
const s = 'Hello, World!';
const c = 'o';
console.time('charCount1');
for(let i = 0; i < 10000; i++) {
charCount1(s, c);
}
console.timeEnd('charCount1');
console.time('charCount2');
for(let i = 0; i < 10000; i++) {
charCount2(s, c);
}
console.timeEnd('charCount2');
console.time('charCount3');
for(let i = 0; i < 10000; i++) {
charCount2(s, c);
}
console.timeEnd('charCount3');
}
Results from a few runs:
perfIt()
charCount1: 3.301ms
charCount2: 11.652ms
charCount3: 174.043ms
undefined
perfIt()
charCount1: 2.110ms
charCount2: 11.931ms
charCount3: 177.743ms
undefined
perfIt()
charCount1: 2.074ms
charCount2: 11.738ms
charCount3: 152.611ms
undefined
perfIt()
charCount1: 2.076ms
charCount2: 11.685ms
charCount3: 154.757ms
undefined
Update 2021-Feb-10: Fixed typo in repl.it demo
Update 2020-Oct-24: Still the case with Node.js 12 (play with it yourself here)
UPDATE 06/10/2022
So I ran various perf tests and if your use case allows it, it seems that using split is going to perform the best overall.
function countChar(char: string, string: string): number {
return string.split(char).length - 1
}
countChar('x', 'foo x bar x baz x')
I know I am late to the party here but I was rather baffled no one answered this with the most basic of approaches. A large portion of the answers provided by the community for this question are iteration based but all are moving over strings on a per-character basis which is not really efficient.
When dealing with a large string that contains thousands of characters walking over each character to get the occurance count can become rather extraneous not to mention a code-smell. The below solutions take advantage of slice, indexOf and the trusted traditional while loop. These approaches prevent us having to walk over each character and will greatly speed up the time it takes to count occurances. These follow similar logic to that you'd find in parsers and lexical analyzers that require string walks.
Using with Slice
In this approach we are leveraging slice and with every indexOf match we will move our way through the string and eliminate the previous searched potions. Each time we call indexOf the size of the string it searches will be smaller.
function countChar (char: string, search: string): number {
let num: number = 0;
let str: string = search;
let pos: number = str.indexOf(char);
while(pos > -1) {
str = str.slice(pos + 1);
pos = str.indexOf(char);
num++;
}
return num;
}
// Call the function
countChar('x', 'foo x bar x baz x') // 3
Using with IndexOf from position
Similar to the first approach using slice but instead of augmenting the string we are searching it will leverage the from parameter in indexOf method.
function countChar (char: string, str: string): number {
let num: number = 0;
let pos: number = str.indexOf(char);
while(pos > -1) {
pos = str.indexOf(char, pos + 1);
num++;
}
return num;
}
// Call the function
countChar('x', 'foo x bar x baz x') // 3
Personally, I go for the second approach over the first, but both are fine and performant when dealing with large strings but also smaller sized ones too.
s = 'dir/dir/dir/dir/'
for(i=l=0;i<s.length;i++)
if(s[i] == '/')
l++
I was working on a small project that required a sub-string counter. Searching for the wrong phrases provided me with no results, however after writing my own implementation I have stumbled upon this question. Anyway, here is my way, it is probably slower than most here but might be helpful to someone:
function count_letters() {
var counter = 0;
for (var i = 0; i < input.length; i++) {
var index_of_sub = input.indexOf(input_letter, i);
if (index_of_sub > -1) {
counter++;
i = index_of_sub;
}
}
http://jsfiddle.net/5ZzHt/1/
Please let me know if you find this implementation to fail or do not follow some standards! :)
UPDATE
You may want to substitute:
for (var i = 0; i < input.length; i++) {
With:
for (var i = 0, input_length = input.length; i < input_length; i++) {
Interesting read discussing the above:
http://www.erichynds.com/blog/javascript-length-property-is-a-stored-value
What about string.split(desiredCharecter).length-1
Example:
var str = "hellow how is life";
var len = str.split("h").length-1; will give count 2 for character "h" in the above string;
The fastest method seems to be via the index operator:
function charOccurances (str, char)
{
for (var c = 0, i = 0, len = str.length; i < len; ++i)
{
if (str[i] == char)
{
++c;
}
}
return c;
}
console.log( charOccurances('example/path/script.js', '/') ); // 2
Or as a prototype function:
String.prototype.charOccurances = function (char)
{
for (var c = 0, i = 0, len = this.length; i < len; ++i)
{
if (this[i] == char)
{
++c;
}
}
return c;
}
console.log( 'example/path/script.js'.charOccurances('/') ); // 2
function len(text,char){
return text.innerText.split(string).length
}
console.log(len("str1,str2,str3,str4",","))
This is a very short function.
The following uses a regular expression to test the length. testex ensures you don't have 16 or greater consecutive non-comma characters. If it passes the test, then it proceeds to split the string. counting the commas is as simple as counting the tokens minus one.
var mainStr = "str1,str2,str3,str4";
var testregex = /([^,]{16,})/g;
if (testregex.test(mainStr)) {
alert("values must be separated by commas and each may not exceed 15 characters");
} else {
var strs = mainStr.split(',');
alert("mainStr contains " + strs.length + " substrings separated by commas.");
alert("mainStr contains " + (strs.length-1) + " commas.");
}
I'm using Node.js v.6.0.0 and the fastest is the one with index (the 3rd method in Lo Sauer's answer).
The second is:
function count(s, c) {
var n = 0;
for (let x of s) {
if (x == c)
n++;
}
return n;
}
And there is:
function character_count(string, char, ptr = 0, count = 0) {
while (ptr = string.indexOf(char, ptr) + 1) {count ++}
return count
}
Works with integers too!
Here's one just as fast as the split() and the replace methods, which are a tiny bit faster than the regex method (in Chrome and Firefox both).
let num = 0;
let str = "str1,str2,str3,str4";
//Note: Pre-calculating `.length` is an optimization;
//otherwise, it recalculates it every loop iteration.
let len = str.length;
//Note: Don't use a `for (... of ...)` loop, it's slow!
for (let charIndex = 0; charIndex < len; ++charIndex) {
if (str[charIndex] === ',') {
++num;
}
}
var mainStr = "str1,str2,str3,str4";
var splitStr = mainStr.split(",").length - 1; // subtracting 1 is important!
alert(splitStr);
Splitting into an array gives us a number of elements, which will always be 1 more than the number of instances of the character. This may not be the most memory efficient, but if your input is always going to be small, this is a straight-forward and easy to understand way to do it.
If you need to parse very large strings (greater than a few hundred characters), or if this is in a core loop that processes large volumes of data, I would recommend a different strategy.
String.prototype.reduce = Array.prototype.reduce;
String.prototype.count = function(c) {
return this.reduce(((n, x) => n + (x === c ? 1 : 0)), 0)
};
const n = "bugs bunny was here".count("b")
console.log(n)
Similar to the prototype based above, but does not allocate an array for the string. Allocation is the problem of nearly every version above, except the loop variants. This avoids loop code, reusing the browser implemented Array.reduce function.
My solution:
function countOcurrences(str, value){
var regExp = new RegExp(value, "gi");
return str.match(regExp) ? str.match(regExp).length : 0;
}
I know this might be an old question but I have a simple solution for low-level beginners in JavaScript.
As a beginner, I could only understand some of the solutions to this question so I used two nested FOR loops to check each character against every other character in the string, incrementing a count variable for each character found that equals that character.
I created a new blank object where each property key is a character and the value is how many times each character appeared in the string(count).
Example function:-
function countAllCharacters(str) {
var obj = {};
if(str.length!==0){
for(i=0;i<str.length;i++){
var count = 0;
for(j=0;j<str.length;j++){
if(str[i] === str[j]){
count++;
}
}
if(!obj.hasOwnProperty(str[i])){
obj[str[i]] = count;
}
}
}
return obj;
}