We Keep Coding

counting the same letters in a string but not in all lenght

I'm starting my adventure with javascript and i got one of first tasks.
I must create function that count letter that most occur in string and write this in console.
For example:
var string = "assssssadaaaAAAasadaaab";
and in console.log should be (7,a) <---
the longest string is 7 consecutive identical characters (yes, before count i use .toLowerCase();, because the task requires it)
So far I have it and I don't know what to do next.
Someone want to help?
var string = "assssssadaaaAAAasadaaab";
var string = string.toLowerCase();
function writeInConsole(){
console.log(string);
var count = (string.match(/a/g) || []).length;
console.log(count);
}
writeInConsole();

One option could be matching all consecutive characters using (.)\1* and sort the result by character length.
Then return an array with the length of the string and the character.
Note that this will take the first longest occurrence in case of multiple characters with the same length.
function writeInConsole(s) {
var m = s.match(/(.)\1*/g);
if (m) {
var res = m.reduce(function(a, b) {
return b.length > a.length ? b : a;
})
return [res.length, res.charAt(0)];
}
return [];
}
["assssssadaaaAAAasadaaab", "a", ""].forEach(s => {
s = s.toLowerCase();
console.log(writeInConsole(s))
});
Another example when you have multiple consecutive characters with the same length
function writeInConsole(s) {
let m = s.match(/(.)\1*/g);
if (m) {
let sorted = m.sort((a, b) => b.length - a.length)
let maxLength = sorted[0].length;
let result = [];
for (let i = 0; i < sorted.length; i++) {
if (sorted[i].length === maxLength) {
result.push([maxLength, sorted[i].charAt(0)]);
continue;
}
break;
}
return result;
}
return [];
}
[
"assssssadaaaAAAasadaaab",
"aaabccc",
"abc",
"yyzzz",
"aa",
""
].forEach(s => {
s = s.toLowerCase();
console.log(writeInConsole(s))
});

I'm no sure if this works for you:
string source = "/once/upon/a/time/";
int count = 0;
foreach (char c in source)
if (c == '/') count++;

The answer given by using regular expressions is more succinct, but since you say you are just starting out with programming, I will offer a verbose one that might be easier to follow.
var string = "assssssadaaaAAAasadaaab";
var string = string.toLowerCase();
function computeLongestRun(s) {
// we set up for the computation at the first character in the string
var longestRunLetter = currentLetter = string[0]
var longestRunLength = currentRunLength = 1
// loop through the string considering one character at a time
for (i = 1; i < s.length; i++) {
if (s[i] == currentLetter) { // is this letter the same as the last one?
currentRunLength++ // if yes, reflect that
} else { // otherwise, check if the current run
// is the longest
if (currentRunLength > longestRunLength) {
longestRunLetter = currentLetter
longestRunLength = currentRunLength
}
// reset to start counting a new run
currentRunLength = 1
currentLetter = s[i]
}
}
return [longestRunLetter, longestRunLength]
}
console.log(computeLongestRun(string))

Word Break algorithm

I'm trying to implement the "Word Break" algorithm.
Problem:
Given a non-empty string s and a dictionary wordDict containing a list of non-empty words, determine if s can be segmented into a space-separated sequence of one or more dictionary words.
Note:
The same word in the dictionary may be reused multiple times in the segmentation.
You may assume the dictionary does not contain duplicate words.
Example:
Input: s = "leetcode", wordDict = ["leet", "code"]
Output: true
Explanation: Return true because "leetcode" can be segmented as "leet code".
My solution:
var wordBreak = function(s, wordDict) {
if(!wordDict || wordDict.length === 0)
return false;
while(wordDict.length > 0 || s.length > 0) {
const word = wordDict.shift();
const index = s.indexOf(word);
if(index === -1) {
return false;
}
s = s.substring(0, index) + s.substring(index+word.length, s.length);
}
return s.length === 0 && wordDict.length === 0 ? true : false;
};
It works for the example (input) above. However it fails for the input below.
Input: s = "applepenapple", wordDict = ["apple", "pen"]
Output: true
Explanation: Return true because "applepenapple" can be segmented as "apple pen apple".
Note that you are allowed to reuse a dictionary word.
How can I keep track of words that I already eliminate and check it at the end. This input above, the remaining s string contains "apple" which is in the word dictionary, so the output should be true.
Thanks

A simple Javascript solution.
This loops through the wordDict array and checks if each word exist in the str. If it doesn't that is when the indexOf the word return -1, the function returns false. However, if the words in the wordDict array are in the string, it returns true at the end of the for loop.
const wordBreak =(str, wordDict)=>{
if (!wordDict || wordDict.length === 0) return false
for(let i=0; I<wordDict.length; i++){
const dictIndex = str.indexOf(wordDict[i])
if(dictIndex === -1){
return false
}
}
return true
}

This is an interesting problem I met two years ago in a different context, i.e., query tokenization. In my case, the number of words in the dictionary was in the order of several million, therefore a recursive approach looking each time for a different word of the dictionary was not practicable. Furthermore, I needed to apply dynamic programming to solve the task for strict efficiency reasons.
First of all, I suggest you to use the AhoCorasick algorithm to find the words within your search string. The algorithm looks for an arbitrary number of patterns in a string in linear time in the length of the string regardless of the number of patterns to find (no more number of words times length of the string operation, indeed each find of a word in a string needs to scan the entire string..).
Luckily, I found a javascript implementation of the algorithm here.
Using the code linked above and dynamic programming to track the words appearing in your string, I wrote the following javascript solution:
function wordBreak(s, wordDict) {
const len = s.length;
const memoization_array_words = new Array(len).fill(null);
const memoization_array_scores = new Array(len).fill(0);
const wordScores = {};
wordDict.forEach(function(word) {
wordScores[word] = 1
});
automata = new AhoCorasick(wordDict);
results = automata.search(s);
results.forEach(function(result) {
// result[0] contains the end position
// result[1] contains the list of words ending in that position
const end_pos = result[0];
result[1].forEach(function(word) {
const prev_end_pos = end_pos - word.length;
const prev_score = (prev_end_pos == -1) ? 0 : memoization_array_scores[prev_end_pos];
const score = prev_score + wordScores[word];
if (score > memoization_array_scores[end_pos]) {
memoization_array_words[end_pos] = word;
memoization_array_scores[end_pos] = score;
}
});
});
if (memoization_array_words[len-1] == null) {
return false;
}
solution = []
var pos_to_keep = len - 1;
while (pos_to_keep >= 0) {
const word = memoization_array_words[pos_to_keep];
solution.push(word);
pos_to_keep -= word.length;
}
return solution.reverse()
}
where memoization_array_words and memoization_array_scores are filled left to right when we meet a word occurring after a previous one or at the beginning of the string s. The code should be autoesplicative, but if you need any explanation write me a comment, please.
As a plus, I associated a score to each word (here is 1 for simplicity) that allows you to distinguish between the different solutions. For instance, if you associate to each word an importance score, you will end up with the tokenization with the greatest score. In the code above, the tokenization with the highest number of words.

Extended version: I testing over the wordDict with some if there is one of the worde that beginns at the test-string (indexOf==0). If so I shorten the string about the length of the word and call the function recursivly with the shortened string. Otherwise the string is not splitable and I return false. I go this way on till an error occurs or the length of the string is 0 and I win because everything goes allright.
Remark: The error when the WordBreak is not clearly like with s= "cars" wordDict = ["car","ca","rs"] is now fixed. For this I calling in the some-methode the algorithm recursivly. So if one way stops before ending I go backwards and search for alternatives till I found one or there is no possibility left.
Remarks to; array.some
In an array.forEach there can't used a break without using some ugly tricks (like try...catch and throwing an error), so I could use the classic variant of the for-loop. But there exists the array.some method this loops like a forEach-loop but there had only one of the elements to be return true so the result is true.
Example:
const array = [1, 2, 3, 4, 5];
// checks whether an element is even
const even = (element) => element % 2 === 0;
console.log(array.some(even));
Here is the code of the working algorithm.
var wordBreak = function(s, wordDict) {
if (!wordDict || wordDict.length === 0) return false;
while (s.length > 0) {
let test = wordDict.some( (word,index) => {
if (s.indexOf(word)===0) {
s_new = s.substr(word.length);
return wordBreak(s_new, wordDict);
}
});
if (!test ) return false;
s=s_new;
}
if (s.length === 0) return true;
}
s = "leetcode"; wordDict = ["leet", "code"];
console.log(wordBreak(s, wordDict));
s = "applepenapple"; wordDict = ["apple", "pen"];
console.log(wordBreak(s, wordDict));
s= "cars"; wordDict = ["car","ca","rs"];
console.log(wordBreak(s, wordDict));

function wordBreak(dict, str){
if (!str){
return true;
}
for (const word of dict){
if (str.startsWith(word)){
return wordBreak(dict, str.substring(word.length, str.length))
}
}
return false;
}
You could also probably optimize the loop over dict by pre-sorting the array and using binary search, but hopefully this gets the point across.

If you'd be looking for a Dynamic Programming solution, we'd use an array for recording, and then we'd loop through and keep track of the word.
This'll pass through in JavaScript:
const wordBreak = function(s, wordDict) {
const len = s.length
const dp = new Array(len + 1).fill(false)
dp[0] = true
for (let i = 1; i < len + 1; i++) {
for (let j = 0; j < i; j++) {
if (dp[j] === true && wordDict.includes(s.slice(j, i))) {
dp[i] = true
break
}
}
}
return dp[s.length]
}
In Python, we would have used a list (which is similar to an array of JavaScript) with the same size as our string:
class Solution:
def wordBreak(self, s, words):
dp = [False] * len(s)
for i in range(len(s)):
for word in words:
k = i - len(word)
if word == s[k + 1:i + 1] and (dp[k] or k == -1):
dp[i] = True
return dp[-1]
Similarly in Java, we'd have used a boolean[]:
public final class Solution {
public static final boolean wordBreak(
String s,
List<String> words
) {
if (s == null || s.length() == 0) {
return false;
}
final int len = s.length();
boolean[] dp = new boolean[len];
for (int i = 0; i < len; i++) {
for (int j = 0; j <= i; j++) {
final String sub = s.substring(j, i + 1);
if (words.contains(sub) && (j == 0 || dp[j - 1])) {
dp[i] = true;
break;
}
}
}
return dp[len - 1];
}
}
Here is LeetCode's DP solution:
public class Solution {
public boolean wordBreak(String s, List<String> wordDict) {
Set<String> wordDictSet=new HashSet(wordDict);
boolean[] dp = new boolean[s.length() + 1];
dp[0] = true;
for (int i = 1; i <= s.length(); i++) {
for (int j = 0; j < i; j++) {
if (dp[j] && wordDictSet.contains(s.substring(j, i))) {
dp[i] = true;
break;
}
}
}
return dp[s.length()];
}
}
References
For additional details, please see the Discussion Board which you can find plenty of well-explained accepted solutions in there, with a variety of languages including efficient algorithms and asymptotic time/space complexity analysis1, 2.

How make a more concise code using the For statement?

I'm new in StackOverflow and JavaScript, I'm trying to get the first letter that repeats from a string considering both uppercase and lowercase letters and counting and obtaining results using the for statement. The problem is that the form I used is too long Analyzing the situation reaches such a point that maybe you can only use a "For" statement for this exercise, which I get to iterate, but not with a cleaner and reduced code has me completely blocked, this is the reason why I request help to understand and continue with the understanding and use of this sentence. In this case, the result was tested in a JavaScript script inside a function and 3 "For" sentences obtaining quite positive results, but I can not create it in 1 only For (Sorry for my bad english google translate)
I making in HTML with JavasScript
var letter = "SYAHSVCXCyXSssssssyBxAVMZsXhZV";
var contendor = [];
var calc = [];
var mycalc = 0;
letter = letter.toUpperCase()
console.log(letter)
function repeats(){
for (var i = 0; i < letter.length; i++) {
if (contendor.includes(letter[i])) {
}else{
contendor.push(letter[i])
calc.push(0)
}
}
for (var p = 0; p < letter.length; p++) {
for (var l = 0; l < contendor.length; l++) {
if (letter[p] == contendor[l]) {
calc [l]= calc [l]+1
}
}
}
for (var f = 0; f < calc.length; f++) {
if ( calc[f] > calc[mycalc]) {
mycalc = f
}
}
}
repeats()
console.log("The most repeated letter its: " + contendor[mycalc]);
I Expected: A result with concise code

It would probably be a lot more concise to use a regular expression: match a character, then lookahead for more characters until you can match that first character again:
var letter = "SYAHSVCXCyXSssssssyBxAVMZsXhZV";
const firstRepeatedRegex = /(.)(?=.*\1)/;
console.log(letter.match(firstRepeatedRegex)[1]);
Of course, if you aren't sure whether a given string contains a repeated character, check that the match isn't null before trying to extract the character:
const input = 'abcde';
const firstRepeatedRegex = /(.)(?=.*\1)/;
const match = input.match(firstRepeatedRegex);
if (match) {
console.log(match[0]);
} else {
console.log('No repeated characters');
}
You could also turn the input into an array and use .find to find the first character whose lastIndexOf is not the same as the index of the character being iterated over:
const getFirstRepeatedCharacter = (str) => {
const chars = [...str];
const char = chars.find((char, i) => chars.lastIndexOf(char) !== i);
return char || 'No repeated characters';
};
console.log(getFirstRepeatedCharacter('abcde'));
console.log(getFirstRepeatedCharacter('SYAHSVCXCyXSssssssyBxAVMZsXhZV'));
If what you're actually looking for is the character that occurs most often, case-insensitive, use reduce to transform the string into an object indexed by character, whose values are the number of occurrences of that character, then identify the largest value:
const getMostRepeatedCharacter = (str) => {
const charsByCount = [...str.toUpperCase()].reduce((a, char) => {
a[char] = (a[char] || 0) + 1;
return a;
}, {});
const mostRepeatedEntry = Object.entries(charsByCount).reduce((a, b) => a[1] >= b[1] ? a : b);
return mostRepeatedEntry[0];
};
console.log(getMostRepeatedCharacter('abcde'));
console.log(getMostRepeatedCharacter('SYAHSVCXCyXSssssssyBxAVMZsXhZV'));

If the first repeated character is what you want, you can push it into an array and check if the character already exists
function getFirstRepeating( str ){
chars = []
for ( var i = 0; i < str.length; i++){
var char = str.charAt(i);
if ( chars.includes( char ) ){
return char;
} else {
chars.push( char );
}
}
return -1;
}
This will return the first repeating character if it exists, or will return -1.
Working
function getFirstRepeating( str ){
chars = []
for ( var i = 0; i < str.length; i++){
var char = str.charAt(i);
if ( chars.includes( char ) ){
return char;
} else {
chars.push( char );
}
}
return -1;
}
console.log(getFirstRepeating("SYAHSVCXCyXSssssssyBxAVMZsXhZV"))

Have you worked with JavaScript objects yet?
You should look into it.
When you loop through your string
let characters = "hemdhdksksbbd";
let charCount = {};
let max = { count: 0, ch: ""}; // will contain max
// rep letter
//Turn string into an array of letters and for
// each letter create a key in the charcount
// object , set it to 1 (meaning that's the first of
// that letter you've found) and any other time
// you see the letter, increment by 1.
characters.split("").forEach(function(character)
{
if(!charCount[character])
charCount[character] = 1;
else
charCount[character]++;
}
//charCount should now contain letters and
// their counts.
//Get the letters from charCount and find the
// max count
Object.keys(charCount). forEach (function(ch){
if(max.count < charCount[ch])
max = { count: charCount[ch], ch: ch};
}
console.log("most reps is: " , max.ch);

This is a pretty terrible solution. It takes 2 loops (reduce) and doesn't handle ties, but it's short and complicated.
Basically keep turning the results into arrays and use array methods split and reduce to find the answer. The first reduce is wrapped in Object.entries() to turn the object back into an array.
let letter = Object.entries(
"SYAHSVCXCyXSssssssyBxAVMZsXhZV".
toUpperCase().
split('').
reduce((p, c) => {
p[c] = isNaN(++p[c]) ? 1 : p[c];
return p;
}, {})
).
reduce((p, c) => p = c[1] > p[1] ? c : p);
console.log(`The most repeated letter is ${letter[0]}, ${letter[1]} times.`);

Find smallest substring containing a given set of letters in a larger string

Say you have the following string:
FJKAUNOJDCUTCRHBYDLXKEODVBWTYPTSHASQQFCPRMLDXIJMYPVOHBDUGSMBLMVUMMZYHULSUIZIMZTICQORLNTOVKVAMQTKHVRIFMNTSLYGHEHFAHWWATLYAPEXTHEPKJUGDVWUDDPRQLUZMSZOJPSIKAIHLTONYXAULECXXKWFQOIKELWOHRVRUCXIAASKHMWTMAJEWGEESLWRTQKVHRRCDYXNT
LDSUPXMQTQDFAQAPYBGXPOLOCLFQNGNKPKOBHZWHRXAWAWJKMTJSLDLNHMUGVVOPSAMRUJEYUOBPFNEHPZZCLPNZKWMTCXERPZRFKSXVEZTYCXFRHRGEITWHRRYPWSVAYBUHCERJXDCYAVICPTNBGIODLYLMEYLISEYNXNMCDPJJRCTLYNFMJZQNCLAGHUDVLYIGASGXSZYPZKLAWQUDVNTWGFFY
FFSMQWUNUPZRJMTHACFELGHDZEJWFDWVPYOZEVEJKQWHQAHOCIYWGVLPSHFESCGEUCJGYLGDWPIWIDWZZXRUFXERABQJOXZALQOCSAYBRHXQQGUDADYSORTYZQPWGMBLNAQOFODSNXSZFURUNPMZGHTAJUJROIGMRKIZHSFUSKIZJJTLGOEEPBMIXISDHOAIFNFEKKSLEXSJLSGLCYYFEQBKIZZTQQ
XBQZAPXAAIFQEIXELQEZGFEPCKFPGXULLAHXTSRXDEMKFKABUTAABSLNQBNMXNEPODPGAORYJXCHCGKECLJVRBPRLHORREEIZOBSHDSCETTTNFTSMQPQIJBLKNZDMXOTRBNMTKHHCZQQMSLOAXJQKRHDGZVGITHYGVDXRTVBJEAHYBYRYKJAVXPOKHFFMEPHAGFOOPFNKQAUGYLVPWUJUPCUGGIXGR
AMELUTEPYILBIUOCKKUUBJROQFTXMZRLXBAMHSDTEKRRIKZUFNLGTQAEUINMBPYTWXULQNIIRXHHGQDPENXAJNWXULFBNKBRINUMTRBFWBYVNKNKDFR
I'm trying to find the smallest substring containing the letters ABCDA.
I tried a regex approach.
console.log(str.match(/[A].*?[B].*?[C].*?[D].*?[A]/gm).sort((a, b) => a.length - b.length)[0]);
This works, but it only find strings where ABCDA appear (in that order). Meaning it won't find substring where the letters appear in a order like this: BCDAA
I'm trying to change my regex to account for this. How would I do that without using | and type out all the different cases?

You can't.
Let's consider a special case: Assume the letters you are looking for are A, A, and B. At some point in your regexp there will certainly be a B. However, the parts to the left and to the right of the B are independent of each other, so you cannot refer from one to the other. How many As are matched in the subexpression to the right of the B depends on the number of As being already matched in the left part. This is not possible with regular expressions, so you will have to unfold all the different orders, which can be many!
Another popular example that illustrates the problem is to match opening brackets with closing brackets. It's not possible to write a regular expression asserting that in a given string a sequence of opening brackets is followed by a sequence of closing brackets of the same length. The reason for this is that to count the brackets you would need a stack machine in contrast to a finite state machine but regular expressions are limited to patterns that can be matched using FSMs.

This algorithm doesn't use a regex, but found both solutions as well.
var haystack = 'FJKAUNOJDCUTCRHBYDLXKEODVBWTYPTSHASQQFCPRMLDXIJMYPVOHBDUGSMBLMVUMMZYHULSUIZIMZTICQORLNTOVKVAMQTKHVRIFMNTSLYGHEHFAHWWATLYAPEXTHEPKJUGDVWUDDPRQLUZMSZOJPSIKAIHLTONYXAULECXXKWFQOIKELWOHRVRUCXIAASKHMWTMAJEWGEESLWRTQKVHRRCDYXNTLDSUPXMQTQDFAQAPYBGXPOLOCLFQNGNKPKOBHZWHRXAWAWJKMTJSLDLNHMUGVVOPSAMRUJEYUOBPFNEHPZZCLPNZKWMTCXERPZRFKSXVEZTYCXFRHRGEITWHRRYPWSVAYBUHCERJXDCYAVICPTNBGIODLYLMEYLISEYNXNMCDPJJRCTLYNFMJZQNCLAGHUDVLYIGASGXSZYPZKLAWQUDVNTWGFFYFFSMQWUNUPZRJMTHACFELGHDZEJWFDWVPYOZEVEJKQWHQAHOCIYWGVLPSHFESCGEUCJGYLGDWPIWIDWZZXRUFXERABQJOXZALQOCSAYBRHXQQGUDADYSORTYZQPWGMBLNAQOFODSNXSZFURUNPMZGHTAJUJROIGMRKIZHSFUSKIZJJTLGOEEPBMIXISDHOAIFNFEKKSLEXSJLSGLCYYFEQBKIZZTQQXBQZAPXAAIFQEIXELQEZGFEPCKFPGXULLAHXTSRXDEMKFKABUTAABSLNQBNMXNEPODPGAORYJXCHCGKECLJVRBPRLHORREEIZOBSHDSCETTTNFTSMQPQIJBLKNZDMXOTRBNMTKHHCZQQMSLOAXJQKRHDGZVGITHYGVDXRTVBJEAHYBYRYKJAVXPOKHFFMEPHAGFOOPFNKQAUGYLVPWUJUPCUGGIXGRAMELUTEPYILBIUOCKKUUBJROQFTXMZRLXBAMHSDTEKRRIKZUFNLGTQAEUINMBPYTWXULQNIIRXHHGQDPENXAJNWXULFBNKBRINUMTRBFWBYVNKNKDFR';
var needle = 'ABCDA'; // the order of letters doesn't matter
var letters = {};
needle.split('').forEach(function(ch) {
letters[ch] = letters[ch] || 0;
letters[ch]++;
});
var shortestSubstringLength = haystack.length;
var shortestSubstrings = []; // storage for found substrings
var startingPos = 0;
var length;
var currentPos;
var notFound;
var letterKeys = Object.keys(letters); // unique leters
do {
lettersLeft = JSON.parse(JSON.stringify(letters)); // copy letters count object
notFound = false;
posStart = haystack.length;
posEnd = 0;
letterKeys.forEach(function(ch) {
currentPos = startingPos;
while (!notFound && lettersLeft[ch] > 0) {
currentPos = haystack.indexOf(ch, currentPos);
if (currentPos >= 0) {
lettersLeft[ch]--;
posStart = Math.min(currentPos, posStart);
posEnd = Math.max(currentPos, posEnd);
currentPos++;
} else {
notFound = true;
}
}
});
if (!notFound) {
length = posEnd - posStart + 1;
startingPos = posStart + 1; // starting position for next iteration
}
if (!notFound && length === shortestSubstringLength) {
shortestSubstrings.push(haystack.substr(posStart, length));
}
if (!notFound && length < shortestSubstringLength) {
shortestSubstrings = [haystack.substr(posStart, length)];
shortestSubstringLength = length;
}
} while (!notFound);
console.log(shortestSubstrings);

Maybe not as clear as using regex could be (well, for me regex are never really clear :D ) you can use brute force (not so brute)
Create an index of "valid" points of your string (those with the letters you want) and iterate with a double loop over it getting substrings containing at least 5 of those points, checking that they are valid solutions. Maybe not the most efficient way, but easy to implement, to understand, and probably to optimize.
var haystack="UGDVWUDDPRQLUZMSZOJPSIKAIHLTONYXAULECXXKWFQOIKELWOHRVRUCXIAASKHMWTMAJEWGEESLWRTQKVHRRCDYXNTLDSUPXMQTQDFAQAPYBGXPOLOCLFQNGNKPKOBHZWHRXAWAWJKMTJSLDLNHMUGVVOPSAMRUJEYUOBPFNEHPZZCLPNZKWMTCXERPZRFKSXVEZTYCXFRHRGEITWHRRYPWSVAYBUHCERJXDCYAVICPTNBGIODLYLMEYLISEYNXNMCDPJJRCTLYNFMJZQNCLAGHUDVLYIGASGXSZYPZKLAWQUDVNTWGFFYFFSMQWUNUPZRJMTHACFELGHDZEJWFDWVPYOZEVEJKQWHQAHOCIYWGVLPSHFESCGEUCJGYLGDWPIWIDWZZXRUFXERABQJOXZALQOCSAYBRHXQQGUDADYSORTYZQPWGMBLNAQOFODSNXSZFURUNPMZGHTAJUJROIGMRKIZHSFUSKIZJJTLGOEEPBMIXISDHOAIFNFEKKSLEXSJLSGLCYYFEQBKIZZTQQXBQZAPXAAIFQEIXELQEZGFEPCKFPGXULLAHXTSRXDEMKFKABUTAABSLNQBNMXNEPODPGAORYJXCHCGKECLJVRBPRLHORREEIZOBSHDSCETTTNFTSMQPQIJBLKNZDMXOTRBNMTKHHCZQQMSLOAXJQKRHDGZVGITHYGVDXRTVBJEAHYBYRYKJAVXPOKHFFMEPHAGFOOPFNKQAUGYLVPWUJUPCUGGIXGR";
var needle="ABCD";
var size=haystack.length;
var candidate_substring="";
var minimal_length=size;
var solutions=new Array();
var points=Array();
for(var i=0;i<size;i++){
if(needle.indexOf(haystack[i])>-1) points.push(i);
}
var limit_i= points.length-4;
var limit_k= points.length;
for (var i=0;i<limit_i;i++){
for(var k=i;k<limit_k;k++){
if(points[k]-points[i]+1<=minimal_length){
candidate_substring=haystack.substr(points[i],points[k]-points[i]+1);
if(is_valid(candidate_substring)){
solutions.push(candidate_substring);
if(candidate_substring.length < minimal_length) minimal_length=candidate_substring.length;
}
}
}
}
document.write('<p>Solution length:'+minimal_length+'<p>');
for(var i=0;i<solutions.length;i++){
if(solutions[i].length<=minimal_length) document.write('<p>Solution:'+solutions[i]+'<p>');
}
function is_valid(candidate_substring){
//verify we've got all characters
for(var j=0;j<candidate_substring.length;j++){
if(candidate_substring.indexOf(needle.charAt(j))<0) return false;
}
//...and verify we have two "A"
if(candidate_substring.indexOf("A")==candidate_substring.lastIndexOf("A")) return false;
return true;
}

Just had this problem in an interview as a coding assignment and came up with another solution, (it's not as optimal as the one above but maybe it's easier to understand).
function MinWindowSubstring(strArr) {
const N = strArr[0];
const K = strArr[1];
const letters = {};
K.split('').forEach( (character) => {
letters[character] = letters[character] ? letters[character] + 1 : 1;
});
let possibleSequencesList = [];
const letterKeys = Object.keys(letters);
for(let i=0; i< N.length; i++) {
const char = N[i];
if (new String(letterKeys).indexOf(char) !== -1) {
// found a character in the string
// update all previus sequences
possibleSequencesList.forEach((seq) => {
if(!seq.sequenceComplete) {
seq[char] = seq[char]-1;
seq.lastIndex = i;
// check if sequence is complete
var sequenceComplete = true;
letterKeys.forEach( (letter) => {
if(seq[letter] > 0) {
sequenceComplete = false;
}
});
seq.sequenceComplete = sequenceComplete
}
})
// create a new sequence starting from it
const newSeq = {
startPoint: i,
lastIndex: i,
sequenceComplete: false,
...letters
}
newSeq[char] = newSeq[char]-1;
possibleSequencesList.push(newSeq);
}
}
// cleanup sequences
let sequencesList = possibleSequencesList.filter(sequence => sequence.sequenceComplete);
let output = [];
let minLength = N.length;
// find the smalles one
sequencesList.forEach( seq => {
if( (seq.lastIndex - seq.startPoint) < minLength) {
minLength = seq.lastIndex - seq.startPoint;
output = N.substring(seq.startPoint, seq.lastIndex + 1);
}
})
return output;
}

for loop string each word

if this type character '這' = NonEnglish each will take up 2 word space, and English will take up 1 word space, Max length limit is 10 word space; How to get the first 10 space.
for below example how to get the result This這 is?
I'm trying to use for loop from first word but I don't know how to get each word in string...
string = "This這 is是 English中文 …";
var NonEnglish = "[^\u0000-\u0080]+",
Pattern = new RegExp(NonEnglish),
MaxLength = 10,
Ratio = 2;

If you mean you want to get that part of the string where it's length has reached 10, here's the answer:
var string = "This這 is是 English中文 …";
function check(string){
// Length of A-Za-z characters is 1, and other characters which OP wants is 2
var length = i = 0, len = string.length;
// you can iterate over strings just as like arrays
for(;i < len; i++){
// if the character is what the OP wants, add 2, else 1
length += /\u0000-\u0080/.test(string[i]) ? 2 : 1;
// if length is >= 10, come out of loop
if(length >= 10) break;
}
// return string from the first letter till the index where we aborted the for loop
return string.substr(0, i);
}
alert(check(string));
Live Demo
EDIT 1:
Replaced .match with .test. The former returns a whole array while the latter simply returns true or false.
Improved RegEx. Since we are checking only one character, no need for ^ and + that were before.
Replaced len with string.length. Here's why.

I'd suggest something along the following lines (assuming that you're trying to break the string up into snippets that are <= 10 bytes in length):
string = "This這 is是 English中文 …";
function byteCount(text) {
//get the number of bytes consumed by a string
return encodeURI(text).split(/%..|./).length - 1;
}
function tokenize(text, targetLen) {
//break a string up into snippets that are <= to our target length
var result = [];
var pos = 0;
var current = "";
while (pos < text.length) {
var next = current + text.charAt(pos);
if (byteCount(next) > targetLen) {
result.push(current);
current = "";
pos--;
}
else if (byteCount(next) == targetLen) {
result.push(next);
current = "";
}
else {
current = next;
}
pos++;
}
if (current != "") {
result.push(current);
}
return result;
};
console.log(tokenize(string, 10));
http://jsfiddle.net/5pc6L/